PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0053200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 238aa    MW: 26201.2 Da    PI: 9.361
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0053200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1071.5e-33136192158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep+YVNaKQy++Il+RRq Rakle+e+kl  k+rkpylheSRh+hA++R+Rg+gGrF
  ORGLA03G0053200.1 136 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKNRKPYLHESRHQHAMKRARGTGGRF 192
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-39134195IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.283135195IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-29137192IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-25138160IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860140160IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-25169192IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
YFIILAENGT VMIQFGHKMP DYESSATQST SGSPREVSGM SEGSLNEQND QSGNLDGYTK  60
SDEGKLMSAL SLGKSETVYA HSEPDRSQPF GISYPYADSF YGGAVATYGT HAIMHPQIVG  120
VMSSSRVPLP IEPATEEPIY VNAKQYHAIL RRRQLRAKLE AENKLVKNRK PYLHESRHQH  180
AMKRARGTGG RFLNTKQQPE ASDGGTPRLV SANGVVFSKH EHSLSSSDLH HRRAKEGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-25135206174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8327050.0CT832705.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105G23, full insert sequence.
GenBankEU8470060.0EU847006.1 Oryza sativa Japonica Group clone KCS364E08 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631822.11e-172PREDICTED: nuclear transcription factor Y subunit A-7
TrEMBLI1P8361e-177I1P836_ORYGL; Uncharacterized protein
STRINGORGLA03G0053200.11e-177(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.16e-44nuclear factor Y, subunit A6